HSPA14 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-HSPA14 Antibody is: synthetic peptide directed towards the N-terminal region of Human HSPA14. Synthetic peptide located within the following region: AVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQILGRSSSDPQAQKYIAE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	heat shock protein family A (Hsp70) member 14
Database Link	NP_057383 Entrez Gene 51182 Human UniProt ID Q0VDF9
Background	HSPA14 is a component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, It binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity.
Synonyms	HSP70-4; HSP70L1
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, Stem cell - Pluripotency

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.