ZFP64 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZFP64 Antibody: synthetic peptide directed towards the middle region of human ZFP64. Synthetic peptide located within the following region: AKKSFHCDICDASFMREDSLRSHKRQHSEYSESKNSDVTVLQFQIDPSKQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	75 kDa
Gene Name	ZFP64 zinc finger protein
Database Link	NP_955459 Entrez Gene 55734 Human UniProt ID Q9NTW7
Background	ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers. ZFP64 may be involved in transcriptional regulation.
Synonyms	ZNF338
Note	Immunogen sequence homology: Dog: 92%; Pig: 92%; Human: 92%; Guinea pig: 92%; Rat: 85%; Mouse: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.