PBXIP1 Rabbit Antibody

Specifications

Product Data
Reactivity	Human
Host	Rabbit
Immunogen	The immunogen for Anti-PBXIP1 Antibody: synthetic peptide directed towards the N terminal of human PBXIP1. Synthetic peptide located within the following region: AGGEGAGGELGISLNMCLLGALVLLGLGVLLFSGGLSESETGPMEEVERQ
Formulation	Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	81 kDa
Database Link	NP_065385 Entrez Gene 57326 Human
Background	PBXIP1 is the regulator of pre-B-cell leukemia transcription factors (BPXs) function. It inhibits the binding of PBX1-HOX complex to DNA and blocks the transcriptional activity of E2A-PBX1. PBXIP1 tethers estrogen receptor-alpha (ESR1) to microtubules and allows them to influence estrogen receptors-alpha signaling.
Synonyms	HPIP
Note	Immunogen sequence homology: Human: 100%; Mouse: 92%; Bovine: 92%; Rat: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.