EPS15R (EPS15L1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-EPS15L1 Antibody is: synthetic peptide directed towards the C-terminal region of Human EPS15L1. Synthetic peptide located within the following region: GFSDDPFKSKQDTPALPPKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	95 kDa
Gene Name	epidermal growth factor receptor pathway substrate 15 like 1
Database Link	NP_067058 Entrez Gene 58513 Human UniProt ID Q9UBC2
Background	EPS15L1 seems to be a constitutive component of clathrin-coated pits that is required for receptor-mediated endocytosis.
Synonyms	EPS15R
Note	Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.