DMRTA1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DMRTA1 Antibody: synthetic peptide directed towards the middle region of human DMRTA1. Synthetic peptide located within the following region: AENPQSTGGPAAGAALGLGALRQASGSATPAFEVFQQDYPEEKQEQKESK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	DMRT like family A1
Database Link	NP_071443 Entrez Gene 63951 Human UniProt ID Q5VZB9
Background	DMRTA1 may be involved in sexual development.
Synonyms	DMO; DMRT4
Note	Immunogen sequence homology: Human: 100%; Horse: 92%; Rat: 86%; Bovine: 85%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.