HROB Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C17orf53 Antibody is: synthetic peptide directed towards the middle region of Human C17orf53. Synthetic peptide located within the following region: QPFQSPSSWLSGKAHLPRPRTPNSSCSTPSRTSSGLFPRIPLQPQAPVSS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	chromosome 17 open reading frame 53
Database Link	NP_076937 Entrez Gene 78995 Human UniProt ID Q8N3J3
Background	The function of this protein remains unknown.
Synonyms	FLJ11594; MGC3130
Note	Immunogen sequence homology: Human: 100%; Horse: 92%; Dog: 86%; Rabbit: 86%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.