C11orf48 (LBHD1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C11orf48 Antibody is: synthetic peptide directed towards the C-terminal region of Human C11orf48. Synthetic peptide located within the following region: RPRADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGSGSP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	LBH domain containing 1
Database Link	NP_077004 Entrez Gene 79081 Human UniProt ID Q9BQE6
Background	The function of this protein remains unknown.
Synonyms	C11orf48
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.