CDADC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CDADC1 Antibody is: synthetic peptide directed towards the C-terminal region of Human CDADC1. Synthetic peptide located within the following region: EGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	cytidine and dCMP deaminase domain containing 1
Database Link	NP_112173 Entrez Gene 81602 Human UniProt ID Q9BWV3
Background	CDADC1 may play an important role in testicular development and spermatogenesis.
Synonyms	bA103J18.1; NYD-SP15
Note	Immunogen sequence homology: Human: 100%; Horse: 90%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.