CFAP300 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C11orf70 Antibody is: synthetic peptide directed towards the C-terminal region of Human C11orf70. Synthetic peptide located within the following region: ELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	chromosome 11 open reading frame 70
Database Link	NP_116319 Entrez Gene 85016 Human UniProt ID Q9BRQ4
Background	The function of this protein remains unknown.
Synonyms	MGC13040
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rabbit: 92%; Rat: 90%; Mouse: 90%; Horse: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.