ABCC12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Abcc12 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	153 kDa
Gene Name	ATP binding cassette subfamily C member 12
Database Link	NP_150229 Entrez Gene 244562 Mouse UniProt ID Q96J65
Background	Abcc12 is a probable transporter.
Synonyms	MRP9
Note	Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	ABC transporters

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.