Arntl2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Arntl2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	aryl hydrocarbon receptor nuclear translocator-like 2
Database Link	NP_758513 Entrez Gene 272322 Mouse UniProt ID Q2VPD4
Background	ARNTL2/CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription. Also, in umbilical vein endothelial cells, Arntl2 activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1.
Synonyms	bHLHe6; BMAL2; CLIF; MGC149671; MGC149672; MOP9; PASD9
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92%; Rabbit: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.