UBR1 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-UBR1 Antibody: synthetic peptide directed towards the N terminal of human UBR1. Synthetic peptide located within the following region: YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 200 kDa |
Gene Name | ubiquitin protein ligase E3 component n-recognin 1 |
Database Link | |
Background | UBR1 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. UBR1 may be involved in pancreatic homeostasis.The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | JBS |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Bovine: 93%; Yeast: 82% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |