LOC285498 (RNF212) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RNF212 Antibody: synthetic peptide directed towards the middle region of human RNF212. Synthetic peptide located within the following region: LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	ring finger protein 212
Database Link	NP_919420 Entrez Gene 285498 Human UniProt ID Q495C1
Background	RNF212 contains 1 RING-type zinc finger. The function of the RNF212 protein remains unknown.
Synonyms	ZHP3
Note	Immunogen sequence homology: Human: 100%; Mouse: 92%; Rabbit: 92%; Dog: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.