PRSS55 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PRSS55 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS55. Synthetic peptide located within the following region: SKMFPKLTKNMLCAGYKNESYDACKGDSGGPLVCTPEPGEKWYQVGIISW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	protease, serine 55
Database Link	NP_940866 Entrez Gene 203074 Human UniProt ID Q6UWB4
Background	This gene encodes a member of a group of membrane-anchored chymotrypsin (S1)-like serine proteases. The enocoded protein is primarily expressed in the Leydig and Sertoli cells of the testis and may be involved in male fertility. Alternate splicing results in multiple transcript variants.
Synonyms	CT153; T-SP1; TSP1; UNQ9391
Note	Immunogen sequence homology: Human: 100%; Pig: 90%; Mouse: 85%; Dog: 79%; Horse: 79%; Bovine: 79%; Guinea pig: 79%; Rat: 77%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.