TBC1D8B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TBC1D8B Antibody is: synthetic peptide directed towards the N-terminal region of Human TBC1D8B. Synthetic peptide located within the following region: FDSNEDITNFVQGKIRGLIAEEGKHCFAKEDDPEKFREALLKFEKCFGLP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	TBC1 domain family member 8B
Database Link	NP_942582 Entrez Gene 54885 Human UniProt ID Q0IIM8
Background	TBC1D8B may act as a GTPase-activating protein for Rab family protein(s).
Synonyms	GRAMD8B
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.