ACCN5 (ASIC5) Rabbit Polyclonal Antibody
CAT#: TA331464
Rabbit polyclonal Anti-ACCN5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,537.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACCN5 antibody: synthetic peptide directed towards the middle region of human ACCN5. Synthetic peptide located within the following region: FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | acid sensing ion channel subunit family member 5 |
Database Link | |
Background | ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known. |
Synonyms | ACCN5; HINAC; INAC |
Note | Human: 100%; Horse: 79% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |