Pou2f1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-POU2F1 antibody: synthetic peptide directed towards the C terminal of mouse POU2F1. Synthetic peptide located within the following region: VTSSTATTLTVNPVLPLTSAAVTNLSLTGKQQPAYRLVSTVPVRFLWRTA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	POU domain, class 2, transcription factor 1
Database Link	NP_945150 Entrez Gene 18986 Mouse UniProt ID P25425
Background	POU2F1 is a member of the POU family that represents the double-stranded DNA binding proteins specifically binding to the block C region.
Synonyms	NF-A1; Oct-1; OCT1; OTF-1; OTF1; OTTHUMP00000032348
Note	Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.