Tppp Rabbit Polyclonal Antibody
CNY 4,381.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Tppp antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQKVQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 24 kDa |
Gene Name | tubulin polymerization promoting protein |
Database Link | |
Background | This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome. |
Synonyms | p24; p25; p25-alpha; p25alpha; TPPP/p25; TPPP1 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Human: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |