C16orf65 (PDZD9) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C16orf65 antibody: synthetic peptide directed towards the middle region of human C16orf65. Synthetic peptide located within the following region: TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	PDZ domain containing 9
Database Link	NP_776167 Entrez Gene 255762 Human UniProt ID Q8IXQ8
Background	The specific function of the protein remains unknown.
Synonyms	C16orf65
Note	Human: 100%; Rabbit: 92%; Dog: 77%; Rat: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.