PGM2L1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PGM2L1 antibody: synthetic peptide directed towards the N terminal of human PGM2L1. Synthetic peptide located within the following region: KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	phosphoglucomutase 2-like 1
Database Link	NP_775853 Entrez Gene 283209 Human UniProt ID Q6PCE3
Background	PGM2L1 is the Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. PGM2L1 has only low phosphopentomutase and phosphoglucomutase activities.
Synonyms	BM32A; PMMLP
Note	Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Zebrafish: 92%
Reference Data
Protein Pathways	Starch and sucrose metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.