CSPP1 Rabbit Polyclonal Antibody
CAT#: TA331390
Rabbit Polyclonal Anti-CSPP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CSPP1 antibody is: synthetic peptide directed towards the N-terminal region of Human CSPP1. Synthetic peptide located within the following region: AEDKAELESDPPYMEMKGKLSAKLSENSKILISMAKENIPPNSQQTRGSL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 96 kDa |
Gene Name | centrosome and spindle pole associated protein 1 |
Database Link | |
Background | CSPP1 interacts with centrosomes and microtubules and plays a role in cell-cycle progression and spindle organization. |
Synonyms | CSPP; JBTS21 |
Note | Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Mouse: 90%; Dog: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |