TOR1AIP2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TOR1AIP2 antibody is: synthetic peptide directed towards the N-terminal region of Human TOR1AIP2. Synthetic peptide located within the following region: PDEANVGKHPKDKTEDENKQSFLDGGKGHHLPSENLGKEPLDPDPSHSPS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	torsin 1A interacting protein 2
Database Link	NP_659471 Entrez Gene 163590 Human UniProt ID Q9H496
Background	TOR1AIP2 regulates the distribution of TOR1A between the endoplasmic reticulum and the nuclear envelope.
Synonyms	IFRG15; LULL1; NET9
Note	Rat: 100%; Human: 100%; Yeast: 100%; Dog: 83%; Horse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.