TESK2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TESK2 antibody is: synthetic peptide directed towards the C-terminal region of Human TESK2. Synthetic peptide located within the following region: AHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFST
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	testis-specific kinase 2
Database Link	NP_009101 Entrez Gene 10420 Human UniProt ID Q96S53
Background	This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain that is structurally similar to the kinase domains of testis-specific protein kinase-1 and the LIM motif-containing protein kinases (LIMKs). Its overall structure is most related to the former, indicating that it belongs to the TESK subgroup of the LIMK/TESK family of protein kinases. This gene is predominantly expressed in testis and prostate. The developmental expression pattern of the rat gene in testis suggests an important role for this gene in meitoic stages and/or early stages of spermiogenesis.
Synonyms	MGC29168; OTTMUSP00000010191; testis-specific kinase 2
Note	Human: 100%; Rabbit: 92%; Horse: 86%; Bovine: 86%; Pig: 83%; Dog: 79%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.