SHC4 Rabbit Polyclonal Antibody

CAT#: TA331357

Rabbit Polyclonal Anti-SHC4 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of SHC (Src homology 2 domain containing) family, member 4 (SHC4)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human SHC (Src homology 2 domain containing) family, member 4 (SHC4), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human SHC (Src homology 2 domain containing) family, member 4 (SHC4), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-SHC4 antibody is: synthetic peptide directed towards the N-terminal region of Human SHC4. Synthetic peptide located within the following region: NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 69 kDa
Gene Name SHC adaptor protein 4
Background SHC4 activates both Ras-dependent and Ras-independent migratory pathways in melanomas. It contributes to the early phases of agrin-induced tyrosine phosphorylation of CHRNB1.
Synonyms RaLP; SHCD
Note Human: 100%
Reference Data
Protein Pathways Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Focal adhesion, Glioma, Insulin signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...