ODF3 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ODF3 antibody is: synthetic peptide directed towards the N-terminal region of Human ODF3. Synthetic peptide located within the following region: IPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 15 kDa |
Gene Name | outer dense fiber of sperm tails 3 |
Database Link | |
Background | ODF3 is a component of sperm flagella outer dense fibers, which add stiffness, elastic recoil, and protection against shearing forces during sperm movement. |
Synonyms | CT135; SHIPPO1; TISP50 |
Note | Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |