EOLA1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CXorf40A antibody is: synthetic peptide directed towards the C-terminal region of Human CXorf40A. Synthetic peptide located within the following region: EDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	chromosome X open reading frame 40A
Database Link	NP_835225 Entrez Gene 91966 Human UniProt ID Q8TE69
Background	CXorf40A may have an important role of cell protection in inflammation reaction.
Synonyms	CXorf40; EOLA1; FLJ16423
Note	Horse: 100%; Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.