TOP1MT Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TOP1MT antibody is: synthetic peptide directed towards the C-terminal region of Human TOP1MT. Synthetic peptide located within the following region: KKRRLLEKLQEQLAQLSVQATDKEENKQVALGTSKLNYLDPRISIAWCKR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	topoisomerase (DNA) I, mitochondrial
Database Link	NP_443195 Entrez Gene 116447 Human UniProt ID Q969P6
Background	This gene encodes a mitochondrial DNA topoisomerase that plays a role in the modification of DNA topology. The encoded protein is a type IB topoisomerase and catalyzes the transient breaking and rejoining of DNA to relieve tension and DNA supercoiling generated in the mitochondrial genome during replication and transcription. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Synonyms	2900052H09Rik; mitochondrial; mitochondrial topoisomerase I; topoisomerase (DNA) I
Note	Rat: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Guinea pig: 92%; Horse: 86%; Dog: 85%; Bovine: 85%; Rabbit: 85%; Zebrafish: 85%; Yeast: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.