RTN4RL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RTN4RL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RTN4RL2. Synthetic peptide located within the following region: DYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	reticulon 4 receptor-like 2
Database Link	NP_848665 Entrez Gene 349667 Human UniProt ID Q86UN3
Background	RTN4RL2 may play a role in regulating axonal regeneration and plasticity in the adult central nervous system.
Synonyms	NgR2; NGRH1
Note	Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.