GPLD1 Rabbit Polyclonal Antibody
CAT#: TA331258
Rabbit Polyclonal Anti-GPLD1 Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 4,628.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 3,080.00
CN¥ 9,998.00
CN¥ 4,840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-GPLD1 antibody is: synthetic peptide directed towards the N-terminal region of Human GPLD1. Synthetic peptide located within the following region: GKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 90 kDa |
Gene Name | glycosylphosphatidylinositol specific phospholipase D1 |
Database Link | |
Background | Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane. |
Synonyms | GPIPLD; GPIPLDM; PIGPLD; PIGPLD1; PLD |
Note | Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 86%; Bovine: 85% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |