G protein alpha 13 (GNA13) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GNA13 antibody is: synthetic peptide directed towards the N-terminal region of Human GNA13. Synthetic peptide located within the following region: SREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	G protein subunit alpha 13
Database Link	NP_006563 Entrez Gene 10672 Human UniProt ID Q14344
Background	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Synonyms	G13
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Long-term depression, Regulation of actin cytoskeleton, Vascular smooth muscle contraction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.