RQCD1 (CNOT9) Rabbit Polyclonal Antibody
CAT#: TA331222
Rabbit Polyclonal Anti-RQCD1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-RQCD1 antibody is: synthetic peptide directed towards the middle region of Human RQCD1. Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 kDa |
Gene Name | CCR4-NOT transcription complex subunit 9 |
Database Link | |
Background | This gene encodes a member of the highly conserved RCD1 protein family. The encoded protein is a transcriptional cofactor and a core protein of the CCR4-NOT complex. It may be involved in signal transduction as well as retinoic acid-regulated cell differentiation and development. Alternatively spliced transcript variants have been described for this gene. |
Synonyms | CAF40; CT129; RCD-1; RCD1; RQCD1 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 86%; Goat: 79% |
Reference Data | |
Protein Pathways | RNA degradation |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Conservation of miRNA-mediated silencing mechanisms across 600 million years of animal evolution
,Mauri, M;Kirchner, M;Aharoni, R;Ciolli Mattioli, C;van den Bruck, D;Gutkovitch, N;Modepalli, V;Selbach, M;Moran, Y;Chekulaeva, M;,
Nucleic Acids Res.
,PubMed ID 27604873
[CNOT9]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |