ALF (GTF2A1L) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	general transcription factor IIA subunit 1 like
Database Link	NP_006863 Entrez Gene 11036 Human UniProt ID Q9UNN4
Background	The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involves the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. ALF is a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.
Synonyms	ALF
Note	Rat: 100%; Horse: 100%; Human: 100%; Dog: 92%; Bovine: 92%; Rabbit: 91%; Pig: 83%; Guinea pig: 83%
Reference Data
Protein Families	Transcription Factors
Protein Pathways	Basal transcription factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.