PCK1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the N terminal of human PCK1. Synthetic peptide located within the following region: PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	phosphoenolpyruvate carboxykinase 1
Database Link	NP_002582 Entrez Gene 5105 Human UniProt ID P35558
Background	PCK1 is a main control point for the regulation of gluconeogenesis. PCK1, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. This gene is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. A mitochondrial isozyme of the encoded protein also has been characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms	PEPCK-C; PEPCK1; PEPCKC
Note	Rat: 100%; Human: 100%; Bovine: 100%; Pig: 92%; Mouse: 92%; Guinea pig: 92%; Dog: 85%; Horse: 85%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Adipocytokine signaling pathway, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, Insulin signaling pathway, Metabolic pathways, PPAR signaling pathway, Pyruvate metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.