Nuclear Factor 1 (NFIA) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NFIA antibody: synthetic peptide directed towards the middle region of human NFIA. Synthetic peptide located within the following region: QHHRPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	nuclear factor I A
Database Link	NP_005586 Entrez Gene 18027 MouseEntrez Gene 4774 Human UniProt ID Q12857
Background	Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization. [supplied by OMIM]
Synonyms	A; CTF; NF-I; NF1-A; NFI-A; NFI-L
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.