SMAD6 Rabbit Polyclonal Antibody

CAT#: TA331111

Rabbit Polyclonal Anti-SMAD6 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,381.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (4)
Transient overexpression lysate of SMAD family member 6 (SMAD6), transcript variant 2
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human SMAD family member 6 (SMAD6), transcript variant 2, 20 µg
    • 20 ug

CN¥ 2,900.00


Recombinant protein of human SMAD family member 6 (SMAD6), transcript variant 2, 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 53 kDa
Gene Name SMAD family member 6
Background SMAD6 (mothers against decapentaplegic homolog 6) is an antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit selectively BMP (bone morphogenetic proteins) signaling by competing with the co-SMAD SMAD4 for receptor-activated SMAD1. SMAD6 is an inhibitory SMAD (I-SMAD) or antagonistic SMAD.
Synonyms AOVD2; HsT17432; MADH6; MADH7
Note Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 93%; Horse: 91%; Zebrafish: 86%
Reference Data
Protein Families Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways TGF-beta signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...