ALG1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ALG1 antibody: synthetic peptide directed towards the N terminal of human ALG1. Synthetic peptide located within the following region: VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
Database Link	NP_061982 Entrez Gene 56052 Human UniProt ID Q9BT22
Background	ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).The biosynthesis of lipid-linked oligosaccharides is highly conserved among eukaryotes and is catalyzed by 14 glycosyltransferases in an ordered stepwise manner. Mannosyltransferase I (MT I) catalyzes the first mannosylation step in this process. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-421 BM767933.1 1-421 422-1179 AY359073.1 416-1173 1180-1444 CA455103.1 259-523 1445-1939 CD366777.1 17-511 c 1940-2122 BC031095.1 1931-2113 2123-2149 BQ002699.1 1-27 c
Synonyms	CDG1K; hMat-1; HMAT1; HMT-1; HMT1; Mat-1; MT-1
Note	Human: 100%; Yeast: 100%; Mouse: 85%; Rat: 79%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, N-Glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.