TMCO1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMCO1 antibody: synthetic peptide directed towards the C terminal of human TMCO1. Synthetic peptide located within the following region: CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	transmembrane and coiled-coil domains 1
Database Link	NP_061899 Entrez Gene 54499 Human UniProt ID Q9UM00
Background	TMCO1 belongs to the TMCO1 family. The exact function of TMCO1 remains unknown.
Synonyms	HP10122; PCIA3; PNAS-136; TMCC4
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.