PCDHGB5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PCDHGB5 antibody is: synthetic peptide directed towards the middle region of Human PCDHGB5. Synthetic peptide located within the following region: LIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSKNSYKLVTDGTLDREQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	89 kDa
Gene Name	protocadherin gamma subfamily B, 5
Database Link	NP_115270 Entrez Gene 56101 Human UniProt ID Q9Y5G0
Background	PCDHGB5 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
Synonyms	PCDH-GAMMA-B5
Note	Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 83%; Bovine: 79%; Horse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.