Peptidase inhibitor 16 (PI16) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PI16 antibody: synthetic peptide directed towards the middle region of human PI16. Synthetic peptide located within the following region: SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	peptidase inhibitor 16
Database Link	NP_699201 Entrez Gene 221476 Human UniProt ID Q6UXB8
Background	PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.
Synonyms	CD364; CRISP9; MSMBBP; PSPBP
Note	Human: 100%; Dog: 93%; Horse: 92%; Pig: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.