ASMT Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ASMT antibody is: synthetic peptide directed towards the N-terminal region of Human ASMT. Synthetic peptide located within the following region: VRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	acetylserotonin O-methyltransferase
Database Link	NP_004034 Entrez Gene 438 Human UniProt ID P46597
Background	This gene belongs to the methyltransferase superfamily, and is located in the pseudoautosomal region (PAR) at the end of the short arms of the X and Y chromosomes. The encoded enzyme catalyzes the final reaction in the synthesis of melatonin, and is abundant in the pineal gland. Alternatively spliced transcript variants have been noted for this gene.
Synonyms	ASMTY; HIOMT; HIOMTY
Note	Human: 100%; Horse: 92%; Dog: 83%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Metabolic pathways, Tryptophan metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.