Apc6 (CDC16) Rabbit Polyclonal Antibody
CAT#: TA330902
Rabbit Polyclonal Anti-CDC16 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 4,840.00
CNY 9,998.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CDC16 antibody is: synthetic peptide directed towards the N-terminal region of Human CDC16. Synthetic peptide located within the following region: RYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 62 kDa |
Gene Name | cell division cycle 16 |
Database Link | |
Background | This gene encodes a component protein of the APC complex, which is composed of eight proteins and functions as a protein ubiquitin ligase. The APC complex is a cyclin degradation system that governs exit from mitosis. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein and two other APC complex proteins, CDC23 and CDC27, contain a tetratricopeptide repeat (TPR), a protein domain that may be involved in protein-protein interaction. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Synonyms | ANAPC6; APC6; CDC16Hs; CUT9 |
Note | Human: 100%; Horse: 93%; Dog: 92%; Pig: 92%; Bovine: 92%; Rat: 86%; Rabbit: 86%; Guinea pig: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |