Apc6 (CDC16) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CDC16 antibody is: synthetic peptide directed towards the N-terminal region of Human CDC16. Synthetic peptide located within the following region: RYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	cell division cycle 16
Database Link	NP_003894 Entrez Gene 8881 Human UniProt ID Q13042
Background	This gene encodes a component protein of the APC complex, which is composed of eight proteins and functions as a protein ubiquitin ligase. The APC complex is a cyclin degradation system that governs exit from mitosis. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein and two other APC complex proteins, CDC23 and CDC27, contain a tetratricopeptide repeat (TPR), a protein domain that may be involved in protein-protein interaction. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Synonyms	ANAPC6; APC6; CDC16Hs; CUT9
Note	Human: 100%; Horse: 93%; Dog: 92%; Pig: 92%; Bovine: 92%; Rat: 86%; Rabbit: 86%; Guinea pig: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.