HEATR7A (MROH1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MROH1 antibody is: synthetic peptide directed towards the N-terminal region of Human MROH1. Synthetic peptide located within the following region: RAAVLRAMERVLSSRASELDKDTASTIILLASSEMTKTKDLVWDWQQAAS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	maestro heat like repeat family member 1
Database Link	NP_001092751 Entrez Gene 727957 Human UniProt ID Q8NDA8
Background	The function of this protein remains unknown.
Synonyms	HEATR7A
Note	Human: 100%; Horse: 86%; Rat: 85%; Bovine: 79%; Dog: 77%; Pig: 77%; Mouse: 77%; Guinea pig: 77%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.