SOHLH2 Rabbit Polyclonal Antibody
CAT#: TA330852
Rabbit Polyclonal Anti-SOHLH2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SOHLH2 antibody is: synthetic peptide directed towards the N-terminal region of Human SOHLH2. Synthetic peptide located within the following region: MSQGSGLHQVSKRQQVDQLPRMQENLVKTLLLKEELDPLKAKIDILLVGD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 55 kDa |
Gene Name | spermatogenesis and oogenesis specific basic helix-loop-helix 2 |
Database Link | |
Background | SOHLH2 is the probable transcription factor, which may be involved in spermatogenesis and oogenesis. |
Synonyms | bHLHe81; SOSF2; SPATA28; TEB1 |
Note | Human: 100%; Dog: 92%; Pig: 83%; Rat: 83%; Guinea pig: 83% |
Reference Data | |
Protein Families | Transcription Factors |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Depletion of follicles accelerated by combined exposure to phthalates and 4-vinylcyclohexene diepoxide, leading to premature ovarian failure in rats.
,null,
Reproductive toxicology (Elmsford, N.Y.)
,PubMed ID 29969652
[SOHLH2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |