SOHLH2 Rabbit Polyclonal Antibody
CAT#: TA330851
Rabbit Polyclonal Anti-SOHLH2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SOHLH2 antibody is: synthetic peptide directed towards the N-terminal region of Human SOHLH2. Synthetic peptide located within the following region: ALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 55 kDa |
Gene Name | spermatogenesis and oogenesis specific basic helix-loop-helix 2 |
Database Link | |
Background | SOHLH2 is the probable transcription factor, which may be involved in spermatogenesis and oogenesis. |
Synonyms | bHLHe81; SOSF2; SPATA28; TEB1 |
Note | Human: 100%; Pig: 91%; Guinea pig: 91%; Dog: 79%; Horse: 79%; Mouse: 75% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |