TPSB2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TPSB2 antibody is: synthetic peptide directed towards the middle region of Human TPSB2. Synthetic peptide located within the following region: QALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	tryptase beta 2 (gene/pseudogene)
Database Link	NP_077078 Entrez Gene 64499 Human UniProt ID P20231
Background	The function of this protein remains unknown.
Synonyms	TPS2; tryptaseB; tryptaseC
Note	Human: 100%; Rat: 92%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.