TMPRSS11B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMPRSS11B antibody is: synthetic peptide directed towards the N-terminal region of Human TMPRSS11B. Synthetic peptide located within the following region: DNCENAASQASTNLSKDIETKMLNAFQNSSIYKEYVKSEVIKLLPNANGS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	transmembrane protease, serine 11B
Database Link	NP_872308 Entrez Gene 132724 Human UniProt ID Q86T26
Background	TMPRSS11B is a probable serine protease.
Synonyms	DKFZp686L1818
Note	Human: 100%; Rabbit: 100%; Rat: 86%; Horse: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.