Cdk15 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Cdk15 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Cdk15. Synthetic peptide located within the following region: ASFHPRGLEAASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	cyclin-dependent kinase 15
Database Link	NP_001028545 Entrez Gene 271697 Mouse UniProt ID Q3V3A1
Background	Cdk15 is a Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin.
Synonyms	ALS2CR7; PFTAIRE2; PFTK2
Note	Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 92%; Rat: 86%; Mouse: 86%; Pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.