C4orf27 (HPF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C4orf27 antibody is: synthetic peptide directed towards the N-terminal region of Human C4orf27. Synthetic peptide located within the following region: GPQCEKTTDVKKSKFCEADVSSDLRKEVENHYKLSLPEDFYHFWKFCEEL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	histone PARylation factor 1
Database Link	NP_060337 Entrez Gene 54969 Human UniProt ID Q9NWY4
Background	The function of this protein remains unknown.
Synonyms	C4orf27
Note	Human: 100%; Horse: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Pig: 79%; Bovine: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.