MTRES1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C6orf203 antibody is: synthetic peptide directed towards the C-terminal region of Human C6orf203. Synthetic peptide located within the following region: TLDLLIGEDKEAGTETVMRILLKKVFEEKTESEKYRVVLRRWKSLKLPKK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	chromosome 6 open reading frame 203
Database Link	NP_057571 Entrez Gene 51250 Human UniProt ID Q9P0P8
Background	The function of this protein remains unknown.
Synonyms	HSPC230; PRED31
Note	Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 79%; Rat: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.