C5orf45 (MRNIP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C5orf45 antibody is: synthetic peptide directed towards the N-terminal region of Human C5orf45. Synthetic peptide located within the following region: QGQVSELPLRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	chromosome 5 open reading frame 45
Database Link	NP_057259 Entrez Gene 51149 Human UniProt ID Q6NTE8
Background	The function of this protein remains unknown.
Synonyms	DKFZp686L2452; MGC65027; MGC78537
Note	Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.